SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for W1E030 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)

No Significant Hits.

Weak hits

Sequence:  W1E030
Domain Number - Region: 4-32
Classification Level Classification E-value
Superfamily Hypothetical protein MG354 0.00706
Family Hypothetical protein MG354 0.016
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) W1E030
Sequence length 44
Comment (tr|W1E030|W1E030_KLEPN) Uncharacterized protein {ECO:0000313|EMBL:CDL14428.1} KW=Complete proteome; Reference proteome OX=1432553 OS=Klebsiella pneumoniae IS46. GN= OC=Enterobacteriaceae; Klebsiella.
Sequence
MSLTHAKKTKKPAEAFCWRVILYSMDFMLQDKTVNHFASRSRWP
Download sequence
Identical sequences W1E030

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]