SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for W1NXJ8 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  W1NXJ8
Domain Number 1 Region: 204-285
Classification Level Classification E-value
Superfamily Ankyrin repeat 3.73e-18
Family Ankyrin repeat 0.003
Further Details:      
 
Domain Number 2 Region: 6-65
Classification Level Classification E-value
Superfamily FYVE/PHD zinc finger 1.53e-17
Family FYVE, a phosphatidylinositol-3-phosphate binding domain 0.0011
Further Details:      
 
Weak hits

Sequence:  W1NXJ8
Domain Number - Region: 182-213
Classification Level Classification E-value
Superfamily GLA-domain 0.0549
Family GLA-domain 0.0067
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) W1NXJ8
Sequence length 291
Comment (tr|W1NXJ8|W1NXJ8_AMBTC) Uncharacterized protein {ECO:0000313|EMBL:ERM99409.1} KW=Complete proteome; Reference proteome OX=13333 OS=Amborella trichopoda. GN=AMTR_s00131p00051160 OC=Amborellaceae; Amborella.
Sequence
MEEPPPFQEASRCDVCKCSFNTFRRRHHCRCCGRTLCNEHSSNQMALPQFGINSNVRVCS
NCFNGASRSDINESQTTSEGMDATTNMVSRLHISEEAIDVQAEPAKERSQVDLPECKCGM
PLCICVTPASDPTPSQVHTTVTPRVHPTTKPKKAINIQATADSTVKNMNTAVNNKPSMFF
SLGQAIDGDFDKHCAQYDCNGEGLREAIKNNDAQVVKKLLSEGVDPNYCDRQGMSLLHLA
ALFNHTEITFILMDHGASTERKNAQGETPVDCAPTMLQYKMRKKLEEGSSK
Download sequence
Identical sequences W1NXJ8
XP_006836556.1.86515 ERM99409

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]