SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for W2KSB8 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)

No Significant Hits.

Weak hits

Sequence:  W2KSB8
Domain Number - Region: 7-117
Classification Level Classification E-value
Superfamily Cag-Z 0.0732
Family Cag-Z 0.009
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) W2KSB8
Sequence length 133
Comment (tr|W2KSB8|W2KSB8_PHYPR) Uncharacterized protein {ECO:0000313|EMBL:ETL88068.1} KW=Complete proteome OX=4792 OS=Phytophthora parasitica (Potato buckeye rot agent). GN=L915_13104 OC=Eukaryota; Stramenopiles; Oomycetes; Peronosporales; Phytophthora.
Sequence
MLESTRYLQSAAWNLCRWSKFTPLTDRVQRLAWNTLNITQPFAFEATCNYLWNGTIVPYP
QHDREAFDLVGDLENTRVIKFRLKKTLNSGATVSILKRAVARRFFDENRMVMVFQIFSEG
EGMFSGMDTDETS
Download sequence
Identical sequences W2KSB8 W2R585
XP_008894341.1.635

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]