SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for W2NAE8 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)

No Significant Hits.

Weak hits

Sequence:  W2NAE8
Domain Number - Region: 8-42
Classification Level Classification E-value
Superfamily T-antigen specific domain-like 0.00235
Family T-antigen specific domain-like 0.014
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) W2NAE8
Sequence length 64
Comment (tr|W2NAE8|W2NAE8_PHYPR) Uncharacterized protein {ECO:0000313|EMBL:ETM44863.1} KW=Complete proteome OX=4792 OS=Phytophthora parasitica (Potato buckeye rot agent). GN=L914_09946 OC=Eukaryota; Stramenopiles; Oomycetes; Peronosporales; Phytophthora.
Sequence
MAREDSQLLMEDMNVFIIVKSQLVPCVVCALTKPHQMRYQLLRCSSETCKAAAPYDACHG
RGRF
Download sequence
Identical sequences W2NAE8

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]