SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for W2VTJ0 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)

No Significant Hits.

Weak hits

Sequence:  W2VTJ0
Domain Number - Region: 18-50
Classification Level Classification E-value
Superfamily Oncogene products 0.0432
Family Oncogene products 0.012
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) W2VTJ0
Sequence length 79
Comment (tr|W2VTJ0|W2VTJ0_PHYPR) Uncharacterized protein {ECO:0000313|EMBL:ETP01600.1} KW=Complete proteome OX=1317063 OS=Phytophthora parasitica CJ01A1. GN=F441_21194 OC=Eukaryota; Stramenopiles; Oomycetes; Peronosporales; Phytophthora.
Sequence
MKAWRQTPDSVVAKSVSICGFSDDPTSWHIARHDVYGTKFRMAWELRSHDGAEDDSGSFD
DCESYEHIMEALDDIVIED
Download sequence
Identical sequences V9DYL2 W2VTJ0 W2Y6E9

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]