SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for W2XX30 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)

No Significant Hits.

Weak hits

Sequence:  W2XX30
Domain Number - Region: 74-109
Classification Level Classification E-value
Superfamily Myosin S1 fragment, N-terminal domain 0.0251
Family Myosin S1 fragment, N-terminal domain 0.0092
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) W2XX30
Sequence length 138
Comment (tr|W2XX30|W2XX30_PHYPR) Uncharacterized protein {ECO:0000313|EMBL:ETP27087.1} KW=Complete proteome OX=1317063 OS=Phytophthora parasitica CJ01A1. GN=F441_00357 OC=Eukaryota; Stramenopiles; Oomycetes; Peronosporales; Phytophthora.
Sequence
MSSALMQSFTKFYTKISDRHELMIVLSYAGDYDIYLPGFWDHLWRNDEWAAHVLNEFRMV
VVVSWSDLASPTIFFIWINPHNNKYEGTTAATITSNKPNPRIIKTDYGQRPNQGSKTKHS
SPHPVKPLVKAKNACHGR
Download sequence
Identical sequences W2XX30

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]