SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for W2Y5M6 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)

No Significant Hits.

Weak hits

Sequence:  W2Y5M6
Domain Number - Region: 33-102
Classification Level Classification E-value
Superfamily MukF C-terminal domain-like 0.0196
Family MukF C-terminal domain-like 0.0047
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) W2Y5M6
Sequence length 205
Comment (tr|W2Y5M6|W2Y5M6_PHYPR) Uncharacterized protein {ECO:0000313|EMBL:ETP30281.1} KW=Complete proteome OX=1317064 OS=Phytophthora parasitica P10297. GN=F442_20692 OC=Eukaryota; Stramenopiles; Oomycetes; Peronosporales; Phytophthora.
Sequence
MVLTNETRHVYPFQWDVVTRAFWNKYPNERLAHVERVDILDRRLDSQGRLVTTRLAKVTQ
KNLPGWVRSALGDCTYVFEETTCDSQRKQLVLKSTNLSLRSVATVEETCVYSVHPDDAQK
TLYEAEAKVTAFVPLLSQKLEKFSVSRGAETAAKGIRAVEEICNDIFQGTFQPAFCESVD
AAKNSVAVNAAKEMANAASKYAEKQ
Download sequence
Identical sequences A0A080Z2X7 A0A0W8DYP2 W2HW89 W2VXN5 W2Y5M6

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]