SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for W4FGP6 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  W4FGP6
Domain Number 1 Region: 104-349
Classification Level Classification E-value
Superfamily WD40 repeat-like 1.69e-68
Family WD40-repeat 0.000000265
Further Details:      
 
Domain Number 2 Region: 2-78
Classification Level Classification E-value
Superfamily Lissencephaly-1 protein (Lis-1, PAF-AH alpha) N-terminal domain 1.09e-19
Family Lissencephaly-1 protein (Lis-1, PAF-AH alpha) N-terminal domain 0.00032
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) W4FGP6
Sequence length 353
Comment (tr|W4FGP6|W4FGP6_9STRA) Uncharacterized protein {ECO:0000313|EMBL:ETV66039.1} KW=Complete proteome; Reference proteome OX=112090 OS=Aphanomyces astaci. GN=H257_17381 OC=Aphanomyces.
Sequence
MVLTGKQREDLHQAILEYLSGLGSTFAQSATAFQQDAGLTMAGESDTTKTGLLEKKWTSV
VRLQRKVMELESKIQQLEEDSKLGGVVSRRDVTGIGRDPSTFLPRAPPKYSMSGHRSPIT
CVVFHPVFSVVVTSSEDATIKVWDFETGEFERTLKGHTNAVQSVAFNPTGTILASSSADL
MIKLWDFSSDGSYECKKTLRGHDHNVCGLVFFPSGDHIVSCSRDTTIKIWEVESGYCTQT
LKGHSDWVRDICITDDGQFLASGGNDRAITLWDLAQGKAIQCMREHEHVVETLQFAARGP
QGAAIEAIHGKKVAETTGQTVARYLLSGSRDRTVRLWEAFSGLLLMNFVRCLP
Download sequence
Identical sequences W4FGP6
XP_009844468.1.97551 XP_009844469.1.97551

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]