SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for W4IHS6 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  W4IHS6
Domain Number 1 Region: 397-496
Classification Level Classification E-value
Superfamily Cdc48 domain 2-like 2.09e-17
Family Cdc48 domain 2-like 0.002
Further Details:      
 
Domain Number 2 Region: 599-644
Classification Level Classification E-value
Superfamily RING/U-box 0.00000000000000101
Family RING finger domain, C3HC4 0.009
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) W4IHS6
Sequence length 646
Comment (tr|W4IHS6|W4IHS6_PLAFA) Uncharacterized protein {ECO:0000313|EMBL:ETW42635.1} KW=Complete proteome OX=1036726 OS=Plasmodium falciparum NF135/5.C10. GN=PFNF135_02907 OC=Plasmodiidae; Plasmodium; Plasmodium (Laverania).
Sequence
MNSYRSSTSKHINFINNVNLKRRKQVIEKKNILEKVHILPIKKNVYNFTKLYQKLNSLIN
EECILYEGFIININEHDMKEKEHEINNKINNCITNEECVNYKNYNTSNVNNINDDEKETH
DYNIDIEQTNTDNTHDKKETIKTKNRDNHNISNNEKQKPTFEYKNNFHNNTDYIIINCVP
STGILSHDTLIYTDGKYVDNLRKIHILIIKDKNYKKYEKKCQKYFGSIKKYLLKKSNQIF
HEAFSFVSYSLDCFSYKLSTKDGTEKKDSDDQLTNIDSSDDVANINSCAQVDKCNKYDQV
DKCNNYDQLAKYTNYDEVANINNYREVKKNKKENVAVDKILMNYLKQYFRKNQNKLYYSG
KLFLINNFTFLTLKIDSDVNVGFIDKNTEIILSVDTYEQYKNVHIVPMYDTLPTTYNYDL
FMDYVKPYIERHYLNVYSIHDTFFYKGVQFKIMGIDPVNIKYGKGRISCNTFIYTEGCIK
PTFFDVISKESINYIRSLPFEYKPYAILNILQHLDSDSLLRLFPSSNINIRENHKKEEKL
LEQLTKHKYIFNKNFKNNYTKNSLENNDSKNKENYHHINRKRELHTTTSTLKSNLINEQC
AVCFEYFQDYDKCIKLTCLHTYHWKCVKNWFKFNLTCPCCRYKLNF
Download sequence
Identical sequences A0A024V608 A0A024W741 A0A024X7Z8 Q8IJW9 W4IHS6 W4J384 W7F7K7 W7K523
gi|124802083|ref|XP_001347357.1| gi|23494936|gb|AAN35270.1| 5833.PF10_0072-1 XP_001347357.1.26446 PF10_0072

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]