SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for W4IRB6 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)

No Significant Hits.

Weak hits

Sequence:  W4IRB6
Domain Number - Region: 2-52
Classification Level Classification E-value
Superfamily Hypothetical protein MG354 0.00222
Family Hypothetical protein MG354 0.016
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) W4IRB6
Sequence length 61
Comment (tr|W4IRB6|W4IRB6_PLAFP) Uncharacterized protein {ECO:0000313|EMBL:ETW52605.1} KW=Complete proteome; Reference proteome OX=57270 OS=Plasmodium falciparum (isolate Palo Alto / Uganda). GN=PFUGPA_05611 OC=Plasmodiidae; Plasmodium; Plasmodium (Laverania).
Sequence
MIHIYKDHKFKMCINHMKKKNISTHCTTYDEKEYFIYIFFKNAYISHYFNVYLSYKAWYG
I
Download sequence
Identical sequences W4IRB6

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]