SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for W4PA01 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)

No Significant Hits.

Weak hits

Sequence:  W4PA01
Domain Number - Region: 149-166
Classification Level Classification E-value
Superfamily T-antigen specific domain-like 0.0497
Family T-antigen specific domain-like 0.0086
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) W4PA01
Sequence length 186
Comment (tr|W4PA01|W4PA01_9BACE) Uncharacterized protein {ECO:0000313|EMBL:GAE16587.1} KW=Complete proteome; Reference proteome OX=1235809 OS=Bacteroides pyogenes JCM 6292. GN=JCM6292_3040 OC=Bacteroides.
Sequence
MTAKRFIFGLLAAVLLTGISFISCGNSSKSRPNSEAVAQAGEDFRTFLNKFTASAAFQYT
RVKFPLRTPIILLLDDGETEKKFPFTKEKWPLLDAETLKEERVEQEEGGVYVSKFIVNEP
KRKVFEAGYEESENDLRVEFELMADGKWYVVDCYTAWYGHDLPVEELEATVREVKEENEA
FKELHP
Download sequence
Identical sequences W4PA01
WP_027325759.1.10687 WP_027325759.1.13775 WP_027325759.1.54252

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]