SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for W5NX33 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  W5NX33
Domain Number 1 Region: 741-856,1021-1071
Classification Level Classification E-value
Superfamily FAD/NAD(P)-binding domain 0.00000000896
Family FAD/NAD-linked reductases, N-terminal and central domains 0.03
Further Details:      
 
Domain Number 2 Region: 539-645
Classification Level Classification E-value
Superfamily Acyl-CoA N-acyltransferases (Nat) 0.000016
Family N-acetyl transferase, NAT 0.034
Further Details:      
 
Weak hits

Sequence:  W5NX33
Domain Number - Region: 259-327
Classification Level Classification E-value
Superfamily Acyl-CoA N-acyltransferases (Nat) 0.000729
Family N-acetyl transferase, NAT 0.047
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) W5NX33
Sequence length 1313
Comment (tr|W5NX33|W5NX33_SHEEP) Cilia and flagella associated protein 61 {ECO:0000313|Ensembl:ENSOARP00000002730} KW=Complete proteome; Reference proteome OX=9940 OS=Ovis aries (Sheep). GN=CFAP61 OC=Pecora; Bovidae; Caprinae; Ovis.
Sequence
MAAAATAGEPGTTEPSPRARPHRATFRQQAGSRNRKRNWLGRPLTSFPRRDGVNVVSVVT
GLRVLFGAWDSGVAGSKMSVLTSPRGKVEVVHCRRTESQDIYCIKNLIRKFTQKLFGNLN
IIYLLEKANLAITLHNDQEEIMAQATFLDYPNWNIATQDDWVSVFRELDSDIPCTPLNTL
FMHLFVAVDEYSVGCCKEIIRTVFKAVLDLHFVFLIVPSCMSLGSTLITVFSQVGYVPSL
TNDEEFAVHVCHRHNHYPQLHIRKARVEDHDNLMPIFLHHDTILKETYGEYFLAELIEAQ
DEENHAVVCEVEGVAVGFMSVCSQVNLELLHKCFDLGPFHGLCVPHQDDILEPPQEFSIH
ESSDSKLENSGEESQKIVKEPQEAVSLETRESIQRKGTEAAVEEALSPVTSENTGEVEDS
EKLSQVSSMVYMGYYISHRSSLSLSLAEDASSFRPIYKGASTAFCIQLFFIDEKYEARSL
DFMNFVFHLFRDKDFCIISVPHLTPEFVLIQSFVKVVPFNNCTLEQDLYVFHRAGLLKTI
EIRLATLSDTPGVEKLISTLMPCKSILEDLKQYNEARRDPDGTPLQVFVAEVAEQVVGIA
VIRNEMDIEYIRSHYNIEDFIYFNHHQREEHGHLYHFVLNPIFRHYTKFFLKEILRLGYK
SCLYYPVYPQVKEGKVQSPKAHSLTSALHYLVPVRPRRQIVYPLEKLGINAPSKEVSKGT
LSYALNHTNRKLSLEPKITVNAKIVVVGASNVGISFLETLVFCSHLKFSNLTLISTYGLP
GKKLLGNEQRKFLANDHCYNDRDHELMSLCSWVNVVAARMTAIDRAAKQVIVSREKVVLY
DHLILCTGRQYQVPCPTEVDISLHPTNREVSNSCLRRYTGPIPCNHFTLNDEEDCLRALA
WIKNNSITTEGNVIIYGNSIDTYTTVETLLNLGVRGSCIHLVQHPPTSIITCINDCAVEG
AIEEALQAAGVNVYRDALLAQWNNGLYSDPIHTASFTTPAKPFQLPCSMFFSFLEKNVDY
ETFKAFNDACLVYDGRLVIDSNFHTNDIAIRAAGPLTKFSNRYYSNEWTHSNFNSKEIGF
QLAAAMLKLFDPTLEPVTEPPADLDRLIPMYKGAKIKGGILPGSYHYLHVSKPAIPTPLE
VQRAQSDFGSEIVTGNVKNGNYFRIHINKYRMVETITCLSKVPFPASNYIRLFGQHEQAL
NNLCARYEDGLVPDLYSYFTEPWCMALFHDRFIDLRKALHQILSSKEDENLPSMEELARQ
IEDEEINLPEKPRNYLKRVFQETIYRPLVEKSILDYLHYNHYHLPMYAWPGII
Download sequence
Identical sequences W5NX33
XP_014955150.1.66739 ENSOARP00000002730

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]