SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for W5P8Y2 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  W5P8Y2
Domain Number 1 Region: 25-54
Classification Level Classification E-value
Superfamily Defensin-like 0.0000398
Family Defensin 0.029
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) W5P8Y2
Sequence length 61
Comment (tr|W5P8Y2|W5P8Y2_SHEEP) Uncharacterized protein {ECO:0000313|Ensembl:ENSOARP00000006889} KW=Complete proteome; Reference proteome OX=9940 OS=Ovis aries (Sheep). GN= OC=Pecora; Bovidae; Caprinae; Ovis.
Sequence
MRTSLFLFAVFFFLAPARSGFFDEKCLKRKGKCIESCQINEELIGFCQKSLKCCVALQPC
G
Download sequence
Identical sequences W5P8Y2
ENSOARP00000006889

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]