SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for W5Q175 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  W5Q175
Domain Number 1 Region: 407-431
Classification Level Classification E-value
Superfamily Notch domain 0.0000667
Family Notch domain 0.0023
Further Details:      
 
Weak hits

Sequence:  W5Q175
Domain Number - Region: 929-1001
Classification Level Classification E-value
Superfamily EF-hand 0.00614
Family Parvalbumin 0.053
Further Details:      
 
Domain Number - Region: 470-497
Classification Level Classification E-value
Superfamily Notch domain 0.0106
Family Notch domain 0.0043
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) W5Q175
Sequence length 1211
Comment (tr|W5Q175|W5Q175_SHEEP) N-acetylglucosamine-1-phosphate transferase alpha and beta subunits {ECO:0000313|Ensembl:ENSOARP00000016461} KW=Complete proteome; Reference proteome OX=9940 OS=Ovis aries (Sheep). GN=GNPTAB OC=Pecora; Bovidae; Caprinae; Ovis.
Sequence
VVLEWSRDQYHVLFDSYRDNIAGKSFQNRLCLPMPIDVVYTWVNGTDLELLKELQQVREQ
MEEEQKAMSREILGKNTTEPTKKSEKPLECLLTHCIKVPMLVLDPALPTNITLKDLPSLY
PSFHSASDVFNVAKPKNPSTNVSVVVFDTTKNVEDAQAGMFKGNSRQTVWRGYLTTDKEV
PGLVLMQDLAFLSGFPPTFKETNQLKAKLPENLSSKIKLLQLYSEASVALLKLNNPKDFQ
ELNKQTKKNMTINGKELTISPAYLLWDLSAISQSKQDEDVSASRFEDNEELRYSLRSIER
HAPWVRNIFIVTNGQIPSWLNLDNPRVTIVTHQDVFRNLSHLPTFSSPAIESHIHRIEGL
SQKFIYLNDDVMFGKDVWPDDFYSHSKGQKVYLTWPVPNCAEGCPGSWIKDGYCDKACNN
SACDWDGGDCSGNSGASRYIAGAGGTGSIGVGQPWHFGAGMTGVSYCNQGCANSWLADKF
CDQACNVLSCGFDAGDCGQDHFHELYKVTLLPNQTHYVIPKGECLPYFSFAEIAKKGIEG
AYSDNPIIRHASIANKWKTIHLLMHSGMNATTIHFNLTLQGKNDEEFKIQIVVEVDTREE
PKRNSTTQKAYHSLMSSTTLHPEAEILFEDIPEEKRFPKVKRHDVNTTRRFQVEVEIPQV
NISLLPKETQLSLNNLDLQLERGDITMKGYNLSKSALLRSFLMNPQNGKLTVNHPLTTEQ
RNGGLEAPLAKQVHRSNLGTSERLQESSPFPAVTVTVNNHSQSQIPPLGARFRAITVTPK
AGDRNVSREKLSSLTFPLESKDTQEKVITGKEQERKTEGNANSYPGGNEVVPGRKLQHYT
DSYLGFLPWEKKKYFQDLLDEEESLKTQLAYFTDSKHTGRQLKDTFADSLRYVNKILNSK
FGFTSRKVPAHMPHMIDRIVMQELQDMFPEEFDKTSFHKVRHSEDMQFAFSYFYYLMSAV
QPLNISQVFDEVDTDQSGILSDREIRTLATRIHDLPLSLQDLTGLEHMLINCSKMLPANI
TQLNNIPPTQEAYYDPNLPPVTKSLVTNCKPVTDKIHKAYKDKNKYRFEIMGEEEIAFKM
IRTNVSHVVGQLDDIRKNPRKFVCLNDNIDHNHKDAQTVKAVLRDFYESMFPIPSQFELP
REYRNRFLHMHELQEWRAYRDKLKFWTHCVLATLIMFTVFSFFAEQLIALKRKIFPRRRI
HKEASPDRIRV
Download sequence
Identical sequences W5Q175
ENSOARP00000016461

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]