SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for W5SVG1 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  W5SVG1
Domain Number 1 Region: 135-196
Classification Level Classification E-value
Superfamily Sigma2 domain of RNA polymerase sigma factors 0.0000000523
Family Sigma2 domain of RNA polymerase sigma factors 0.0026
Further Details:      
 
Weak hits

Sequence:  W5SVG1
Domain Number - Region: 85-121
Classification Level Classification E-value
Superfamily RecG, N-terminal domain 0.068
Family RecG, N-terminal domain 0.012
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) W5SVG1
Sequence length 231
Comment (tr|W5SVG1|W5SVG1_9SPIR) RNA polymerase sigma factor rpoD {ECO:0000313|EMBL:AHH10905.1} KW=Complete proteome OX=1313292 OS=Borrelia coriaceae Co53. GN=BCO_0044400 OC=Bacteria; Spirochaetes; Spirochaetales; Borreliaceae; Borrelia.
Sequence
MNSVENKDLQAFKKKNSKIIKDILSHLGDKKAITFEDLSIFLSGDMLESENIDYIYGVLE
HEGISLINEKMETDICDIDEFDEASKLDSQCMMIDDSVHSDDDVDDKLDEFDDEILDKED
FSSGYIKSGLLKDSNSEDPIRLYLKEIGKEFLLTGNQEVELAKQMDSGESIIENILKNEG
LVIENYYNLVDAIYSRVDKEEFFKKDKEREKDNSFDYYNKKKGSLLFIKLH
Download sequence
Identical sequences W5SVG1

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]