SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for W6SHS2 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)

No Significant Hits.

Weak hits

Sequence:  W6SHS2
Domain Number - Region: 14-66
Classification Level Classification E-value
Superfamily Multimerization domain of the phosphoprotein from sendai virus 0.0314
Family Multimerization domain of the phosphoprotein from sendai virus 0.02
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) W6SHS2
Sequence length 79
Comment (tr|W6SHS2|W6SHS2_9CLOT) Uncharacterized protein {ECO:0000313|EMBL:CDM69260.1} KW=Complete proteome; Reference proteome OX=1216932 OS=Clostridium bornimense. GN=CM240_2102 OC=Clostridium.
Sequence
MKRIKAACIKQTLHFMLKEDLGHDYAVKMVDEEVKKYKSQLDRSKTQYKIIAEERQADGS
VIIEIIKQYNTSPVGDYLK
Download sequence
Identical sequences W6SHS2
WP_044038987.1.57199

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]