SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for W7EWN5 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  W7EWN5
Domain Number 1 Region: 21-206
Classification Level Classification E-value
Superfamily Gametocyte protein Pfg27 1.24e-97
Family Gametocyte protein Pfg27 0.00000000597
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) W7EWN5
Sequence length 217
Comment (tr|W7EWN5|W7EWN5_PLAF8) Uncharacterized protein {ECO:0000313|EMBL:EUR66704.1} KW=Complete proteome OX=57266 OS=Plasmodium falciparum (isolate 7G8). GN=PFBG_04284 OC=Plasmodiidae; Plasmodium; Plasmodium (Laverania).
Sequence
MSKVQKDSAKPLDKFGNIYDYHYEHETHAPLSPRIRKVGDIEFHACSDYIYLLMTLSKDP
EKFNYALKDRVSIRRYVRKNQNRYNYFLIEEHVQDNIVNRISDRLISYCTDKEVTEDYIK
KIDDYLWVEQRVIEEVSINVDHAREVKEKKRIMNDKKLIRMLFDTYEYVKDVKFTDDQYK
DAAARISQFLIDVVDSYIIKPIPALPVTPDEPHHNNI
Download sequence
Identical sequences W7EWN5

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]