SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for W7F4N6 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  W7F4N6
Domain Number 1 Region: 94-232
Classification Level Classification E-value
Superfamily ISP domain 1.7e-38
Family Rieske iron-sulfur protein (ISP) 0.00000294
Further Details:      
 
Domain Number 2 Region: 51-106
Classification Level Classification E-value
Superfamily ISP transmembrane anchor 0.00000000000000209
Family ISP transmembrane anchor 0.0018
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) W7F4N6
Sequence length 233
Comment (tr|W7F4N6|W7F4N6_COCVI) Cytochrome b-c1 complex subunit Rieske, mitochondrial {ECO:0000256|RuleBase:RU004494} KW=Complete proteome OX=930091 OS=Bipolaris victoriae FI3. GN=COCVIDRAFT_83893 OC=Pleosporaceae; Bipolaris.
Sequence
MPALANTARAVARSWTAHQLPVARAAGCTAMQTRNASASSFDSPFKGTPETTKIPSFAAY
RNKGGETGPKVFQYFMVGTMGALSALGAKATVQDFLVNMSASADVLAQAKVEIDLAAIPE
GKNVIIKWRGKPVFIRHRTEDEIKEAEDTKWESLRDPQPDSARVQKPEWLIMLGVCTHLG
CVPIGEAGDFGGWFCPCHGSHYDISGRIRKGPAPLNLEVPSYDFPEEGKVVIG
Download sequence
Identical sequences M2TKD7 M2UQM7 N4XZU9 W6YFZ0 W6YX45 W7F4N6
jgi|Cocvi1|83893|e_gw1.0.519.1 XP_007689507.1.18027 XP_007694898.1.66866 XP_007715544.1.9443 XP_014084641.1.79200 XP_014562717.1.39273 jgi|CocheC5_1|80673|estExt_Genewise1.C_20732 jgi|Cocca1|7755|gm1.7755_g jgi|Cocmi1|6669|gm1.6669_g

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]