SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for W7KAV2 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  W7KAV2
Domain Number 1 Region: 84-121
Classification Level Classification E-value
Superfamily TSP-1 type 1 repeat 0.0000118
Family TSP-1 type 1 repeat 0.0057
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) W7KAV2
Sequence length 137
Comment (tr|W7KAV2|W7KAV2_PLAFO) Uncharacterized protein {ECO:0000313|EMBL:EWC90190.1} KW=Complete proteome; Reference proteome OX=5843 OS=Plasmodium falciparum (isolate NF54). GN=PFNF54_00951 OC=Plasmodiidae; Plasmodium; Plasmodium (Laverania).
Sequence
MKRLCDNSNDVGFKSMSVVIDYELAVLCKDGSNKDYADFEIIGASGYITGEEMIEEQKRN
PWYVPRKCTVNNFYLCRKVENDNVNCSYTPWSDWSACKNNTQKRYRKVRRSNQNNENFCL
WNDKIVPRNIMEQTRSC
Download sequence
Identical sequences A0A024VI94 A0A024WXY2 W7KAV2

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]