SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for W8X1I9 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)

No Significant Hits.

Weak hits

Sequence:  W8X1I9
Domain Number - Region: 143-211
Classification Level Classification E-value
Superfamily Periplasmic binding protein-like II 0.00063
Family Phosphate binding protein-like 0.034
Further Details:      
 
Domain Number - Region: 226-255
Classification Level Classification E-value
Superfamily DNA-binding domain of EIN3-like 0.0732
Family DNA-binding domain of EIN3-like 0.011
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) W8X1I9
Sequence length 342
Comment (tr|W8X1I9|W8X1I9_CASDE) TRAP-type transport system, periplasmic component, predicted N-acetylneuraminate-binding protein {ECO:0000313|EMBL:CDM22751.1} KW=Complete proteome; Reference proteome OX=1437824 OS=Castellaniella defragrans 65Phen. GN=BN940_01371 OC=Alcaligenaceae; Castellaniella.
Sequence
MKLKALFLAATLAAGAMAPQAQAADIQTRLIRFGYGLNQDSNQGRAVQVFADEVAKLSGG
KMKIRAIGAAALGSDIQMQQALIGGAQEMMVGSTATLVGITPEMAMWDTPFLFNSGEEAD
KILDGRAGQMLMEKLSDKGLVGLVYWENGFRNLTNSQKPVTRVEDFGGLKLRVMQNTVFL
DTFQRLGANAIPLPFSELFTALETKTVDGQENPYNTILSSKFYEVQKYLSITNHVYSPWI
VTASKKWWDGLSADERDVLLKAAVVSRDFERKDTRAEADKALAQLKADGMQINEVAPAEI
ERMRETIKPVNEQIKQNVGPAVWQAVQNQLKAIRQGTDLARN
Download sequence
Identical sequences W8X1I9
WP_043679309.1.22391

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]