SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for W9X681 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  W9X681
Domain Number 1 Region: 35-98
Classification Level Classification E-value
Superfamily Hydrophobin II, HfbII 3.14e-22
Family Hydrophobin II, HfbII 0.0012
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) W9X681
Sequence length 100
Comment (tr|W9X681|W9X681_9EURO) Uncharacterized protein {ECO:0000313|EMBL:EXJ72411.1} KW=Complete proteome; Reference proteome OX=1182543 OS=Cladophialophora psammophila CBS 110553. GN=A1O5_04915 OC=Cladophialophora.
Sequence
MHFSTVAIVLAGVTTAMASAIPGKSALVDRQVTLCSGADSSAVCCATDVLRVADLDCAPP
PSTPTSIDDFTSICASIGQQARCCLLPILEQGLICTSPGK
Download sequence
Identical sequences W9X681
XP_007743709.1.26421

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]