SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for X0LML8 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)

No Significant Hits.

Weak hits

Sequence:  X0LML8
Domain Number - Region: 5-33
Classification Level Classification E-value
Superfamily Small-conductance potassium channel 0.0222
Family Small-conductance potassium channel 0.011
Further Details:      
 
Domain Number - Region: 5-135
Classification Level Classification E-value
Superfamily C-terminal domain of PLC-beta 0.0536
Family C-terminal domain of PLC-beta 0.016
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) X0LML8
Sequence length 218
Comment (tr|X0LML8|X0LML8_FUSOX) Uncharacterized protein {ECO:0000313|EMBL:EXM27148.1} KW=Complete proteome OX=1089449 OS=Fusarium oxysporum f. sp. vasinfectum 25433. GN=FOTG_06533 OC=Fusarium; Fusarium oxysporum species complex.
Sequence
MTPAERLRKNQRMLDKAIRELDQMRVKLEKQEKTLIQQIKTSAKNGQMGACKIQAKDLVR
TRRYVEKFYSMRSQLQKISLRLQTYRTNEQMMQAMKGATMALGSMNKSMNLPQLQRIAME
FERENDIMDQRQEMMDDAIDDAMDVGIEEEGDEVVEQVLEEIGVDFNQALGETPTALGTA
AVPEGKIAQAVGGGGGGGGGGGDPVDDDLQARLDSLRK
Download sequence
Identical sequences X0LML8

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]