SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for X0QC87 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)

No Significant Hits.

Weak hits

Sequence:  X0QC87
Domain Number - Region: 30-54
Classification Level Classification E-value
Superfamily Proteinase A inhibitor IA3 0.0248
Family Proteinase A inhibitor IA3 0.0056
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) X0QC87
Sequence length 76
Comment (tr|X0QC87|X0QC87_9GAMM) Uncharacterized protein {ECO:0000313|EMBL:GAF54369.1} KW=Complete proteome OX=1298608 OS=Psychrobacter sp. JCM 18900. GN=JCM18900_13000 OC=Moraxellaceae; Psychrobacter.
Sequence
MANALDDDDNHELQAIFLDAHDNEKYVRLKKHREFLKSIAHKMQGEAKMVSSSFTSHKDN
QDSEYGSLFDDKSAAQ
Download sequence
Identical sequences X0QC87

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]