SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for X0VGX4 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  X0VGX4
Domain Number 1 Region: 43-67,140-185
Classification Level Classification E-value
Superfamily TPR-like 0.0000599
Family Tetratricopeptide repeat (TPR) 0.032
Further Details:      
 
Weak hits

Sequence:  X0VGX4
Domain Number - Region: 22-127
Classification Level Classification E-value
Superfamily Mannose-6-phosphate receptor binding protein 1 (Tip47), C-terminal domain 0.0523
Family Mannose-6-phosphate receptor binding protein 1 (Tip47), C-terminal domain 0.013
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) X0VGX4
Sequence length 256
Comment (tr|X0VGX4|X0VGX4_9ZZZZ) Uncharacterized protein {ECO:0000313|EMBL:GAG17520.1} OX=412755 OS=marine sediment metagenome. GN=S01H1_58176 OC=unclassified sequences; metagenomes; ecological metagenomes.
Sequence
QQEQIFQSAKELDLRRRQFEEKREDETKKEKHFFTILSNADGILQSRNYEEAINEYQNAL
KLIEALGPGWETYVSNINNTISNIQKIKNSQLKKEYEVQQKLEIREIKELEFQKQIANQL
DKERKHLKQKEIVLKDKEKEIIYLEQRKNVAFDSLDSAMNYIKQGDYDNAIIAYQNAGNI
FAEIQWKDEIPIIEKSILKVEELRKNQKILKQKRMQETLERQKEDDAFQKQISQYLKQER
EKLKKGEIELKKREEE
Download sequence
Identical sequences X0VGX4

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]