SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for X0XKK8 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)

No Significant Hits.

Weak hits

Sequence:  X0XKK8
Domain Number - Region: 2-17
Classification Level Classification E-value
Superfamily Hypothetical protein Ta0289 C-terminal domain 0.0222
Family Hypothetical protein Ta0289 C-terminal domain 0.0065
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) X0XKK8
Sequence length 66
Comment (tr|X0XKK8|X0XKK8_9ZZZZ) Uncharacterized protein {ECO:0000313|EMBL:GAG43705.1} OX=412755 OS=marine sediment metagenome. GN=S01H1_78147 OC=unclassified sequences; metagenomes; ecological metagenomes.
Sequence
AQNGDLKVLHCGNPNCSVPQPVGGIAEVPDVSDSAGRNYAALAALAAAAVVALGAGGWYA
RRRRLG
Download sequence
Identical sequences X0XKK8

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]