SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for X1DGA1 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)

No Significant Hits.

Weak hits

Sequence:  X1DGA1
Domain Number - Region: 18-55
Classification Level Classification E-value
Superfamily FAT domain of focal adhesion kinase 0.0418
Family FAT domain of focal adhesion kinase 0.018
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) X1DGA1
Sequence length 58
Comment (tr|X1DGA1|X1DGA1_9ZZZZ) Uncharacterized protein {ECO:0000313|EMBL:GAH04049.1} OX=412755 OS=marine sediment metagenome. GN=S01H4_42127 OC=unclassified sequences; metagenomes; ecological metagenomes.
Sequence
MCYVNNFNDPYEPKAIELLQGKGKIFKRDMANLIDEVRRVLPEVFKSEDYAAKRDATM
Download sequence
Identical sequences X1DGA1

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]