SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for X8IVW2 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)

No Significant Hits.

Weak hits

Sequence:  X8IVW2
Domain Number - Region: 24-65
Classification Level Classification E-value
Superfamily Staphylocoagulase 0.00942
Family Staphylocoagulase 0.0066
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) X8IVW2
Sequence length 75
Comment (tr|X8IVW2|X8IVW2_9STRE) Uncharacterized protein {ECO:0000313|EMBL:EUC53126.1} KW=Complete proteome OX=936576 OS=Streptococcus sp. ACS2. GN=HMPREF1517_1344 OC=Streptococcus.
Sequence
MLFVNGELNDYDNVTACIHKHVKASPEEFIEAMNRKLSLEDRFLLDQSLEEYQLYQKLMN
KLTSEIIAYIEKEFP
Download sequence
Identical sequences X8IVW2

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]