SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for Z9JZ80 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)

No Significant Hits.

Weak hits

Sequence:  Z9JZ80
Domain Number - Region: 3-29
Classification Level Classification E-value
Superfamily Fibritin 0.0549
Family Fibritin 0.011
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Z9JZ80
Sequence length 107
Comment (tr|Z9JZ80|Z9JZ80_9GAMM) Uncharacterized protein {ECO:0000313|EMBL:EWS96980.1} KW=Complete proteome OX=1461766 OS=Pseudoalteromonas sp. SCSIO_11900. GN=BG00_03855 OC=Pseudoalteromonadaceae; Pseudoalteromonas.
Sequence
MKSYSSIEQRIDILQSRIEAYQEEIKVLQAEPKSNNERIIFKFIETGSTGKTKDFVRELG
IKSPRDSLYSSGDVTKLIKDGADDISPELLSIARSLASARNKNGPAC
Download sequence
Identical sequences Z9JZ80
WP_036983129.1.69096

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]