SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for A0A014Q9I8 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)

No Significant Hits.

Weak hits

Sequence:  A0A014Q9I8
Domain Number - Region: 58-122
Classification Level Classification E-value
Superfamily Pseudo ankyrin repeat-like 0.0353
Family Pseudo ankyrin repeat 0.053
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) A0A014Q9I8
Sequence length 307
Comment (tr|A0A014Q9I8|A0A014Q9I8_9BURK) Segregation and condensation protein A {ECO:0000256|SAAS:SAAS00952062} KW=Complete proteome; Reference proteome OX=1457173 OS=Comamonas aquatica DA1877. GN=AX13_03095 OC=Comamonadaceae; Comamonas.
Sequence
MSDSAPDTAPAELPATAASANADLMPDVVDQVALARLYGEPLFKLPNDLYIPPDALEVFL
EAFEGPLDLLLYLIRKQNFNILDIPMLAVTQQYLRYVDEIRNRNLELAAEYLLMAAMLIE
IKSRMLLPPKKKEGEEEAEDPRAELVRRLLEYEKMKLAAQQISTLPQYGRDFLKAQVHIE
QSLQPRFPDVAVGELQAAWRDILKRAKLVQHHRITREELSVREYMSQILKQLQGQRFVEF
ERIFDPSKGSTVLVVTFIALLELGKETLIEITQAEAYAPIYVRLAYRPAATTASAPLELE
EELYERD
Download sequence
Identical sequences A0A014Q9I8
WP_051519532.1.72260

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]