SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for A0A016BST4 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)

No Significant Hits.

Weak hits

Sequence:  A0A016BST4
Domain Number - Region: 58-111
Classification Level Classification E-value
Superfamily SMI1/KNR4-like 0.00471
Family SMI1/KNR4-like 0.012
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) A0A016BST4
Sequence length 115
Comment (tr|A0A016BST4|A0A016BST4_BACFG) Uncharacterized protein {ECO:0000313|EMBL:EXZ84558.1} KW=Complete proteome OX=1339273 OS=Bacteroides fragilis str. B1 (UDC16-1). GN=M069_1016 OC=Bacteroides.
Sequence
MKKLKSPASQSEAMKLRWKKRIVFEKGYTESCAEWMAERLEALLDHMQYGHATVAYRKQN
GSFQLVKATLIYYEAEFHKKYDPAEVEGAVVYWNVDEQRWTTFQVENFMEWRPVV
Download sequence
Identical sequences A0A016BST4 A0A0E2TD55 A0A2J6AP53
WP_032575960.1.21713 WP_032575960.1.26832 WP_032575960.1.31541 WP_032575960.1.51373 WP_032575960.1.52936 WP_032575960.1.54019

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]