SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for A0A016CDB6 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)

No Significant Hits.

Weak hits

Sequence:  A0A016CDB6
Domain Number - Region: 63-111
Classification Level Classification E-value
Superfamily SMI1/KNR4-like 0.00824
Family SMI1/KNR4-like 0.012
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) A0A016CDB6
Sequence length 115
Comment (tr|A0A016CDB6|A0A016CDB6_BACFG) Uncharacterized protein {ECO:0000313|EMBL:EXZ91783.1} KW=Complete proteome OX=1339269 OS=Bacteroides fragilis str. Korea 419. GN=M065_5860 OC=Bacteroides.
Sequence
MKKLKSPASQSEAMKLRWKKRIVFEKGYTESCAEWMAERLEALLDHMQYGHATVAYRKQN
GSFQLVKATLIYYEAEFRKKYDPTKIEGAVVYWNVDEQRWTTFQVENFMEWRPIV
Download sequence
Identical sequences A0A016CDB6 A0A0E2AFY9 A0A0E2S9I8 A0A0K6BRB7 Q5LHB0
WP_005784912.1.10083 WP_005784912.1.21107 WP_005784912.1.26934 WP_005784912.1.37988 WP_005784912.1.57121 WP_005784912.1.58084 WP_005784912.1.69826 WP_005784912.1.85293 WP_005784912.1.9461 272559.BF0728 gi|60680284|ref|YP_210428.1| 396886

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]