SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for A0A016EV51 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)

No Significant Hits.

Weak hits

Sequence:  A0A016EV51
Domain Number - Region: 4-53
Classification Level Classification E-value
Superfamily Regulator of G-protein signaling, RGS 0.0182
Family Regulator of G-protein signaling, RGS 0.019
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) A0A016EV51
Sequence length 57
Comment (tr|A0A016EV51|A0A016EV51_BACFG) Uncharacterized protein {ECO:0000313|EMBL:EYA21974.1} KW=Complete proteome OX=1339337 OS=Bacteroides fragilis str. 1007-1-F #3. GN=M146_5059 OC=Bacteroides.
Sequence
MEISFVAFSERQPAKNVQLFNIYCKNNCFIMRNSKNIFKFAADIISRYLRSNGYFFN
Download sequence
Identical sequences A0A015SE45 A0A015UTB5 A0A015V9D7 A0A015WR30 A0A015YVM5 A0A015ZEN0 A0A016BJE0 A0A016CDQ5 A0A016EV51 A0A017PIS2 A0A0E2RYL0 A0A0E2SRI4 A0A0E2TJ37 A0A139TI03 A0A149NRN5

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]