SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for A0A016TDH2 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  A0A016TDH2
Domain Number 1 Region: 15-110
Classification Level Classification E-value
Superfamily Chaperone J-domain 5.63e-28
Family Chaperone J-domain 0.00024
Further Details:      
 
Domain Number 2 Region: 66-216
Classification Level Classification E-value
Superfamily Thioredoxin-like 3.25e-26
Family PDI-like 0.016
Further Details:      
 
Domain Number 3 Region: 509-594
Classification Level Classification E-value
Superfamily Thioredoxin-like 0.00000000000000422
Family PDI-like 0.033
Further Details:      
 
Weak hits

Sequence:  A0A016TDH2
Domain Number - Region: 330-421
Classification Level Classification E-value
Superfamily Thioredoxin-like 0.00193
Family PDI-like 0.025
Further Details:      
 
Domain Number - Region: 212-308
Classification Level Classification E-value
Superfamily Thioredoxin-like 0.0219
Family PDI-like 0.058
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) A0A016TDH2
Sequence length 619
Comment (tr|A0A016TDH2|A0A016TDH2_9BILA) Uncharacterized protein {ECO:0000313|EMBL:EYC00999.1} KW=Complete proteome; Reference proteome OX=53326 OS=Ancylostoma ceylanicum. GN=Y032_0111g238 OC=Ancylostoma.
Sequence
MRIPLLFLVLIVAVIADEDYYKLLGIERDADDRTIRKAFKKLAIQKHPDKNKDNPNAHAE
FVKINKAYEVLKDEETRKKYDQFGEKGLEDGFQGGNNYQSWQFYNENFGIYDDDPEIVTL
NRADFQRQVSDSNEMWFINFYSTYCSHCHQLAPTWRKFARVMEGAVRIGAVNCAEDPGLC
QSQRVHAYPSLVVYPTGEFYTGVRDLELLQEFILQRMTAEILHLGSDNIEALTTEWEPYD
SRPWIIDFCDETDSCLSPANRRKLAAMLDGLVNVGNVNCRANAEHELCEFLDASMGVSYY
PARQVQKGYEKKMNSLDPKELADEVLTYLDAIEEIGEQDLQELLEGTSWPTSVLFVSNKN
DLNERKDYKKLPAALPDVKILFVDCSKYMDKCRAVLDVQKLPQFVTFKTTGGYEIDYDGT
VGKPPKSEEKRGVGNLHHPTSLVARHEIDFNAHRFSVVHAAATPTSPRPKIDRHRDQYHK
QRWHIVLYSASTLYKMLNKKSYYDVRAFIKESATSPLHVLDEDAYNAAISSGELWIVDYF
APWCPPCLRLIGEYRRLHSIIDRKDEVVSKIRIGLIDCQKYNQICQKAGVQRFDIFQALN
ASLRLPIIGKRVDASVNDR
Download sequence
Identical sequences A0A016TDH2

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]