SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for A0A016UE87 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  A0A016UE87
Domain Number 1 Region: 200-319
Classification Level Classification E-value
Superfamily Thioredoxin-like 0.00000000000000291
Family UAS domain 0.016
Further Details:      
 
Domain Number 2 Region: 368-434
Classification Level Classification E-value
Superfamily Ubiquitin-like 0.0000878
Family UBX domain 0.039
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) A0A016UE87
Sequence length 555
Comment (tr|A0A016UE87|A0A016UE87_9BILA) Uncharacterized protein {ECO:0000313|EMBL:EYC13241.1} KW=Complete proteome; Reference proteome OX=53326 OS=Ancylostoma ceylanicum. GN=Y032_0044g1054 OC=Ancylostoma.
Sequence
MVNERSTGSDAVDVPASAQVIDQSTLNRDLEALHTAPSFQSAVLAVDLDLTQNDSITSKS
ADLVTANDWDVLTAVLTEAQRISSESMLRTPPEEFDAVDVRTAISSMNGTGERAGETTGL
MSTDFSLSSMFPSIFGRGATAQTTRPVTRRDTRSASTRSPSGNAAFRIPEAPKKPKDARR
DIVRFRSDYANKFAIGSQHTVNFFSGSYDDAQREAKSLIRLLIVFIHDPNSQDSTRLIHE
TLNSREFDTFVSNNHLIVWGVASDSEEGKYVAYNLHVYKFPFMSVMCPRADNRMFSVRRI
TGFVAAKDLVEKLQKAVDVTRSELKELQEQRSKLIADRQIKEQQEREYRESAERDKRKML
AAKKARQEKLEAEEKERRRISDTESRRKAIAAEREKLRLQITKPPVTGEIVNVQIRFPSG
AKFSRKFAVDDTLELTRLSTIYVEQAKRDIIRAWVHNVEITPGKRVGPMSMNGWKNSLQE
LFVAIICHEKCPDFFTVASGFPRCQIHCAPEWYHSLLSQQLAADGATPSAFRPAGSFREA
GLRRAVAVFVNNCET
Download sequence
Identical sequences A0A016UE87

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]