SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for A0A022Q1X6 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  A0A022Q1X6
Domain Number 1 Region: 139-272
Classification Level Classification E-value
Superfamily DNA-binding pseudobarrel domain 1.7e-40
Family B3 DNA binding domain 0.0035
Further Details:      
 
Domain Number 2 Region: 706-782
Classification Level Classification E-value
Superfamily CAD & PB1 domains 0.0000000000461
Family PB1 domain 0.027
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) A0A022Q1X6
Sequence length 832
Comment (tr|A0A022Q1X6|A0A022Q1X6_ERYGU) Auxin response factor {ECO:0000256|RuleBase:RU004561} KW=Complete proteome; Reference proteome OX=4155 OS=Erythranthe guttata (Yellow monkey flower) (Mimulus guttatus). GN=MIMGU_mgv1a001371mg OC=Pentapetalae; asterids; lamiids; Lamiales; Phrymaceae; Erythranthe.
Sequence
MAASEVSIKGYSDANDCNSGTDKANSGAGKVDTETALYTELWRACAGPLVTVPRENELVF
YFPQGHMEQVEASTNQSADQQMPVYNLPPKILCRVVNVNLKAEPDTDEVFAQVTLMPEPN
QDENAAKKEPLPSPPPCFHVHSFCKTLTASDTSTHGGFSVLRRHADECLPPLDMSRQPPT
QELVAKDLHGNEWRFRHIFRGQPRRHLLQSGWSVFVSSKRLVAGDAFIFLRGENGELRVG
VRRAMRQQGNAPSSVISSHSMHLGVLATAWHAIQTKTMFTVYYKPRTSPAEFIVSYDQYM
ESVKNNYSIGMRFKMRFEGEEAPEQRFTGTIVGTEDADSKRWPESKWRCLKVRWDETSTI
PRPERVSPWKIEPALSPPALNPLPVPRPKRPRSSVLPSSPDSSVLTREGPSKMTVDPSPA
NGFQRVLQGQELSTLRGTFAESNESEASEKPLLWNPSLDEDKIDALSASKRYMPDKWLPI
GRPESSFTDLLSGFGSQISGSRDFCMPPGDEAVSKRQRQDQQHEAKFSFIGNNNNWSIMP
SGLSLNLMDSSQGQGTTDVRYGGGFREYSLMPDSRGGDNQQRNWLMPPPISPYLQMGPAQ
PRELMPKSAFMQQQPSHDSMKPKEGNCKLFGIPLRSSSNSASLDQTLSQRTAMIERASHM
QLGLHSHQSPAIESDQSKGSKMVDSPVATSEQDKPVTKVHSGSTRSCTKVHKQGTALGRS
VDLAKFDNYDELIAELDNLFEFNGELKAKTKNWLVVYTDDEDDMMLVGDDPWDEFCGMVR
KILILTKEEVQRMSPGTFNSKGEEMSSVAEGLDAKEVKNLPATTSSSSPDNC
Download sequence
Identical sequences A0A022Q1X6
XP_012856487.1.32330 mgv1a001371m|PACid:17697052

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]