SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for A0A022Q7N3 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  A0A022Q7N3
Domain Number 1 Region: 112-232
Classification Level Classification E-value
Superfamily DNA-binding pseudobarrel domain 2.75e-30
Family B3 DNA binding domain 0.0016
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) A0A022Q7N3
Sequence length 522
Comment (tr|A0A022Q7N3|A0A022Q7N3_ERYGU) Auxin response factor {ECO:0000256|RuleBase:RU004561} KW=Complete proteome; Reference proteome OX=4155 OS=Erythranthe guttata (Yellow monkey flower) (Mimulus guttatus). GN=MIMGU_mgv1a004523mg OC=Pentapetalae; asterids; lamiids; Lamiales; Phrymaceae; Erythranthe.
Sequence
MSNFSSSSSAVATASEVDASIWRAVAGACVQIPPPNSFVYYFPQGHLEHCSFSTAFINSF
NFALGRPFIYCQVLSIRFFSNHLSDQVFVKITLQPINTYGPCPVSNAGGDRENNQGDVVL
FSKILTPSDANNGGGFSVPRSCADMIFPPLDFAADPPVQNLTLKDTNNNAWEFRHIYRGT
PRRHLLTTGWSKFVNAKRLVAGDSAVFMRKQSTDELYIGVRRAQRFGGIEGQNGGEALRA
IENAVKGMAFEVLYCPTFGSPDFVVKAEKVCEATRTNWTAGMRVKMAVEADDSSRLTWSS
GTIAAVSCPNTGPWCGSPWGLLQMTWDEPESMRNVNRVSPWQVEYLDPTLMLNPNFPPLK
KLKLLSYSDMLLSAGEGEIPFPTAEFNSPLFNASIQGARLDPVYIPTTTTTNSQVSKEIP
DKNEGEPERETVSTVLSIGSSYSDKDNVSPPSQSSVASATKLVRENSFQLFGQIIQMPQP
GEDGACCSNAVSEENPVIDHQLPSPSARVQQQQRFRRPSDKS
Download sequence
Identical sequences A0A022Q7N3
mgv1a004523m|PACid:17674410 XP_012853330.1.32330

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]