SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for A0A022QL99 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  A0A022QL99
Domain Number 1 Region: 147-258
Classification Level Classification E-value
Superfamily DNA-binding pseudobarrel domain 1.7e-42
Family B3 DNA binding domain 0.0048
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) A0A022QL99
Sequence length 621
Comment (tr|A0A022QL99|A0A022QL99_ERYGU) Auxin response factor {ECO:0000256|RuleBase:RU004561} KW=Complete proteome; Reference proteome OX=4155 OS=Erythranthe guttata (Yellow monkey flower) (Mimulus guttatus). GN=MIMGU_mgv1a002959mg OC=Pentapetalae; asterids; lamiids; Lamiales; Phrymaceae; Erythranthe.
Sequence
MMCGLIDLNTVDNEDETASPSGSPTSSAASGNFEFSVPPSSAAVCMELWHACAGPLISLP
KKGSAVVYFPQGHLEQLREHTAVAYDLPPHVFCRVVDVKLHADAASDEVYAQVSLVPDQQ
IEQNWREGMIETEVEDEDPEGMGKSMTPHMFCKTLTASDTSTHGGFSVPRRAAEDCFPPL
DYKQQRPSQELVAKDLHGVEWKFRHIYRGQPRRHLLTTGWSAFVNKKKLVSGDAVLFLRG
GDGELRLGIRRAAQVKSNATILHPNSNHFNASSVVAVVNSISMRSTFNICYNPRAHSSEI
IVPYHKFSKSLTHSFSCGMRFKIRFETEDSSERRCSGLIIGVNEVDPARWPGSKWKCLLV
RWDDMDVNRLNRVSPWEIELSGSVSGSNSFVLPGNKRDGNEVSDFGEPLRFQKVLQGQEV
FAFRTPYAGAEASRHHQSDMRCYPGLSMRHLHPDSFDTSVLGESFQFQNKVLQGQETISL
YGRGPQANHHTPQVDNNAANIINGVQVSNHGNSWSTLPQVFNSNPHRSLPFQFTPSANHG
DHGMVPTGGKEVAFPHRPVPTQQFFRDNENFVSMCKNSCRLFGFPLTEGKITTMGMGENA
TASSGSASAYGVRDRLLDIAL
Download sequence
Identical sequences A0A022QL99
mgv1a002959m|PACid:17690862

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]