SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for A0A022R916 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  A0A022R916
Domain Number 1 Region: 599-768
Classification Level Classification E-value
Superfamily Tropomyosin 0.00000687
Family Tropomyosin 0.0037
Further Details:      
 
Weak hits

Sequence:  A0A022R916
Domain Number - Region: 114-213
Classification Level Classification E-value
Superfamily Myosin rod fragments 0.0549
Family Myosin rod fragments 0.0075
Further Details:      
 
Domain Number - Region: 33-79
Classification Level Classification E-value
Superfamily Fibritin 0.0628
Family Fibritin 0.0086
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) A0A022R916
Sequence length 865
Comment (tr|A0A022R916|A0A022R916_ERYGU) Uncharacterized protein {ECO:0000313|EMBL:EYU36776.1} KW=Complete proteome; Reference proteome OX=4155 OS=Erythranthe guttata (Yellow monkey flower) (Mimulus guttatus). GN=MIMGU_mgv1a001210mg OC=Pentapetalae; asterids; lamiids; Lamiales; Phrymaceae; Erythranthe.
Sequence
MDKRSWPWKKKSSNSSALDKVKHDSENEKPKFIQIPTESYANLTGLVDQVKSYEEQVRNL
EEEVKELNGKLSEAHSEMTDKENVVKQHAKVAEEAISGWEKAEAEAATLKTQVESVTLLK
LTAEDRGTHLDGALKECMRQIRDLKEEHSKKLQEVIHNKTKLFDKMKLDLESKISDLEQE
LCNSADENAALSTSLRDCSNMLTQLGEEKSEAESEIRLLNSNIESYEKEVSSLKYEVHIA
RKEVEIRNEEKNMSVRSAELANKQHIEGAKKIAKLEAECQRLRGLVRKKLPGPAALAQMK
LEVEHMGRDYAESRLRKSHLPEFSFENSLKIHKEHEQLTERMLSMDEETRMLKEALAKRN
GELEASRSLYEETAVKLRSLEAELRGNGERLSSRKGIEDGNDDNHSYVCKEKNLDSPHIS
EKSSRLCLMDDFLEMEKFANETDPKTVESLSEDVKSCMDSVQTINQELEIAISYICDIVK
MLGKEAETSADRDELNEEIDTFSAKYNEAINSKMVNLVEFVLDISRVLSKANELHLNVTG
FKSCEVENSSSDCIDKIVLPENKALLEDSSGERYPNSCSQFSDSASDPDIPSDAKLVPTS
ESPWKCSFEEFEQLKADLAISTANLESTKSQLLETEQLLADVKLQLTSAQKSNTLAETQV
KCMAESYRSLETRAEELQTEINSLQTKIENMDNELQKEKASHQDALTRCNDLLEQLQRVD
NSSATVDNIDKASQEAELAAASEKLAECQETIFLLGKQLKSLRPQTDIQNSTTNSGEQPT
ISGMNFQPTIDFGATSFSLHRAGSESFLDPFNSQFGTSDSEANKPPLRSKHRPTKSGSCS
ASPTPSEKQSRGFSRFFSSKGKNSY
Download sequence
Identical sequences A0A022R916
mgv1a001210m|PACid:17679094

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]