SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for A0A022RJW6 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)

No Significant Hits.

Weak hits

Sequence:  A0A022RJW6
Domain Number - Region: 1025-1102
Classification Level Classification E-value
Superfamily G protein-binding domain 0.00146
Family Rabaptin-5 0.027
Further Details:      
 
Domain Number - Region: 327-389
Classification Level Classification E-value
Superfamily Tropomyosin 0.00222
Family Tropomyosin 0.0054
Further Details:      
 
Domain Number - Region: 241-486
Classification Level Classification E-value
Superfamily Tropomyosin 0.00894
Family Tropomyosin 0.0005
Further Details:      
 
Domain Number - Region: 491-730
Classification Level Classification E-value
Superfamily Tropomyosin 0.0507
Family Tropomyosin 0.002
Further Details:      
 
Domain Number - Region: 1140-1376
Classification Level Classification E-value
Superfamily Tropomyosin 0.085
Family Tropomyosin 0.00091
Further Details:      
 
Domain Number - Region: 734-954
Classification Level Classification E-value
Superfamily Tropomyosin 0.0899
Family Tropomyosin 0.0012
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) A0A022RJW6
Sequence length 1745
Comment (tr|A0A022RJW6|A0A022RJW6_ERYGU) Uncharacterized protein {ECO:0000313|EMBL:EYU40033.1} KW=Complete proteome; Reference proteome OX=4155 OS=Erythranthe guttata (Yellow monkey flower) (Mimulus guttatus). GN=MIMGU_mgv1a000117mg OC=Pentapetalae; asterids; lamiids; Lamiales; Phrymaceae; Erythranthe.
Sequence
MPKHRWRKSFKSFFGSHVDSVKDEELRGNRAEMEDRVQKILKSLREDDNDGKEPLVDLIE
DFNNHYQSLFAHYDHLTEELRKKAHGKNGKDSSSSSSDSSDSDQSSPKKKGEKNGEVKKS
FEKQELEAALFEVAELKSKLTITLDENETLNRDYQSVLSKTEEAQKIITELNAEVERSKD
ESSKLFVENGDLKIELESSHKLQAELSQKLEAVSVEREAALCKIDEAKKSTEDLRLVNGQ
LQLEKDTVQLELEAVKVEFSTLREKLESAENEIAKLIEMQKVSEEEKTSLSSQISQFEEE
IQHAKNKIQDLVTESSMLGEKLADREREILSYEAQKEEAKEKLESAEKEIDKVNDMRKAA
EEENSSLSSKISQLEEDIKQAEKKIQDLISESSQLSERTVVKEREFTSHLEYHEAHKEDA
KEKLESAAKEIAVLSQMHNADEEEKTSLSLKISQLENEIKMAENKIQDLVTESSQLNEKL
VVKEGELSSHLEIHEAHKEEAKQKSELAANEIAKLTQMHNAAQEEKTSLCLKISQLENEI
KMAESKIQELVTESSQLSEKLVEKEEELSRQQEIHEAHKEEAKQKSELAANEIAKLMQMH
NAAEEEKTSLSLKISQLENEIKMAESKIQELVTESSQLNEKLVVKEGELSSNLEIHEAHK
VEGIQKLELAANEIAKLTQMNNAAEEEKTSLSLKISQLENGIIIAESKIQELVNESSQLS
EKLVVKEGELSSHLEILVAHKEEAKQKSELAANEIAKLTQMHSAAEEEKTSLSLKISQLE
NEIKMAEKKIQDLATESSQLSEKLVEKEEELSSHLEIHNAYKVKLESAEEEIVKLIQTQK
AAEEENNNLSLKISELENEIKLSENKIQELVIESSQLRENLADKEKELLSHLESHEAQKE
EAREKLESAANEIAKLSQMQKASEEENASLSLKIAQLVDEIKEAENKIQDLVTESSHKLA
EKERELSTHLETHHAHKEQVSIRTRDLELELDSSHTQRREIEKQKNDELSALLKKLEDQE
LGLLNQINDLKAQNNSFQAEVESLRSQKVELEEQIVHKNNEASAKIKDLTDQVNTKQVEL
ESLHNQKVESEAQLEKRIKEISEFVTQIENLKEELANKNSELNGIIEEKENLMLQTLGKE
LETRTSEKQKTLEERDGLVLELNNLKTEFNILSDQKQELEEQLRSKSEELSQLQEERAKL
EDRSSVMERALIEKENELSTLQKKYEEGESGSLAQITALTADVNGLQEQLISLGAQKSEA
DTILDKKSGEISELLVQIEHLKEELSSKTGEGERLLEEKESLTVQVKDLQLELETLRRNK
GELEDEISIKLDEGNQLREEKGVLESKIIELEKTLVERGDEVVSVQKKMEEVQNEASVEV
SALTKQVESLQKELELLQSEKSQLEVQIERSKQESTESLSLADKNNVELLNKIAENETKL
KEEEGALIKLSDEHKQLEVEFQKSEENLKSAEKKIEEMTLQFHNDTEAKTQDIDLLQENI
EELKRDLEMKVDEINTLVENVRNIEVKHRLISQKLKITEQLLSEKDEDHLKKEEKLHEEQ
KLLEERVAKFARIIAVHKEAETKIVAEISKNVDLTSTGIDAFHVKFEEDYGHLESRVYEF
VNELKVATNCIRETNIEREKLKKDIASLATQLNEEKDKELLLEGKIGEMEIVLRKNESEK
KSLIENVGELEKKIEEKDLGLVSLGEEKIEAIKQLSIWIEYHRNRYDELKEMVAKSRGGR
RQIAA
Download sequence
Identical sequences A0A022RJW6
mgv1a000117m|PACid:17683821

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]