SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for A0A022RW65 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)

No Significant Hits.

Weak hits

Sequence:  A0A022RW65
Domain Number - Region: 193-248
Classification Level Classification E-value
Superfamily BAG domain 0.0322
Family BAG domain 0.0057
Further Details:      
 
Domain Number - Region: 97-273
Classification Level Classification E-value
Superfamily Tropomyosin 0.0981
Family Tropomyosin 0.0078
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) A0A022RW65
Sequence length 350
Comment (tr|A0A022RW65|A0A022RW65_ERYGU) Uncharacterized protein {ECO:0000313|EMBL:EYU44289.1} KW=Complete proteome; Reference proteome OX=4155 OS=Erythranthe guttata (Yellow monkey flower) (Mimulus guttatus). GN=MIMGU_mgv1a009190mg OC=Pentapetalae; asterids; lamiids; Lamiales; Phrymaceae; Erythranthe.
Sequence
MAGLLAWAADVVGGGGGGRSDEDNDPNSIPLIFTPDQLTYVRELDLKSASLNRSIQDLRL
RLPPPDISQRLPHLHAHSLASNNDLALQLNAHSTTKQQTQLRQVRLEEENADYQSAISNC
EIKIQEKLHEADSLRSKLKEMDLIERNLEEEWQRAKSSVDAKNLGESTEVLNESQSSTVG
VQEEAEAPKSALMEKLDNKKKELASMEEIVQELEKEWQRVQDNALKQPTPAQREKTLDKQ
LHSLIEQLAAKQAQAEGLMGEIHIKEMELEKLNGMWRRIESSSLYTRNRFGRSGSYKENI
SSDYSTDSRQKLPIHTAGRNETLQRLMLLRSAFVLYILVLHILVFIKISF
Download sequence
Identical sequences A0A022RW65
XP_012852383.1.32330 mgv1a009190m|PACid:17691908

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]