SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for A0A022RXC9 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  A0A022RXC9
Domain Number 1 Region: 131-229
Classification Level Classification E-value
Superfamily DNA-binding pseudobarrel domain 2.35e-22
Family B3 DNA binding domain 0.0052
Further Details:      
 
Weak hits

Sequence:  A0A022RXC9
Domain Number - Region: 425-474
Classification Level Classification E-value
Superfamily Tropomyosin 0.0268
Family Tropomyosin 0.0069
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) A0A022RXC9
Sequence length 483
Comment (tr|A0A022RXC9|A0A022RXC9_ERYGU) Uncharacterized protein {ECO:0000313|EMBL:EYU44388.1} KW=Complete proteome; Reference proteome OX=4155 OS=Erythranthe guttata (Yellow monkey flower) (Mimulus guttatus). GN=MIMGU_mgv1a005456mg OC=Pentapetalae; asterids; lamiids; Lamiales; Phrymaceae; Erythranthe.
Sequence
MKLKILHQSPESQRLMKGENLEIDEMEEEPQIRVSPEMENSPHQELPLVNAFHPMLVSGK
RKRKPKELIDDFVPIIRVRKKNSSSSKSKDVTPPGHAAALMRKVDCTFGRSSNAQSNSPT
MVRAEEVQSSLSNDQPNFLKFLVRSHVGSCFWMGLPVPFCKVYLPSEDTMVILENENGEE
FPVKYIANKTGLSAGWRKFVAGSKLLEGDVLIFQLIGPCRFKVYIIRANDLTEVDEASMD
AQIKKRRHRKSLPLKIVHKKKRNESSFGSHPEKQPEEHSGNDSDEVASEVLECTKFNESS
FNFKDVKTFEDFHIVVNGVCIDSELPEQIRRKYYELCSSKNAYLHERLLPGLYTKLACGI
IDQTIKIADCIKSCNLTTPRKDFEVWEKSLRSFELLGLNVGFLRARLNHLLTLAFDSEDA
FEIRRYWEVQNDKSLTEDEIKKLEIKIDELKEACEKYDREIEDLKRKAESYEVKFLEEVN
APW
Download sequence
Identical sequences A0A022RXC9
mgv1a005456m|PACid:17674612

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]