SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for A0A022S400 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  A0A022S400
Domain Number 1 Region: 283-382
Classification Level Classification E-value
Superfamily DNA-binding pseudobarrel domain 3.66e-19
Family B3 DNA binding domain 0.0012
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) A0A022S400
Sequence length 773
Comment (tr|A0A022S400|A0A022S400_ERYGU) Uncharacterized protein {ECO:0000313|EMBL:EYU46020.1} KW=Complete proteome; Reference proteome OX=4155 OS=Erythranthe guttata (Yellow monkey flower) (Mimulus guttatus). GN=MIMGU_mgv1a027022mg OC=Pentapetalae; asterids; lamiids; Lamiales; Phrymaceae; Erythranthe.
Sequence
MGSQNCMNEACRGTTSSEWKKGWTLKSGGFATLCYTCGSAYENSIFCDKFHAEESGWREC
KICGKRVHCGCIVSRFLHEYMDYGGVGCMSCIPSDISNGTFLTNGIRDTRPIIVENRIDD
DKFSTERLLQLTKAIGTSDFSSAFQQFKQEESMLNKTRQTNKRLLNLTQECSPPKDANES
ILPRPSLNFSLTPPILPYSGGVVDGIELSKNSPQQGGLKARHILPKPPKPSPIELNKGSF
SQARVARPPAEGRGRNQLLPRYWPKITDQELQQLSGDLKSTIVPLFEKILSASDAGRIGR
LVLPKACAEAYFPPINQSEGIPINIQDIKGKEWLFQFRFWPNNNSRMYVLEGVTPCIQNM
QVQAGDTVIFSRIDPGGQLVIGCRKATNIFDLQNGGRTSDDSLQRHMSTTLSEKKKARNI
KNKRLLMHNEDAMELRVTWEEAQELLRPTPNAEPTFVMIEDHLFEEFQEPPIFGKRTIFT
SRISGEQEQLAQCDSCLKWRRLPVHALLSGKWTCSENTWDSKRCSCYAPEDINPRDLESC
ISAYKDSKKRKVSDKASNKEGEPSGLDALATAAVLGDNNNNIVGAESSSVGAAATTRHPR
HRPGCSCIVCIQPPSGKGKHEPTCKCNVCLTVKRRFKTLMMRKKKRQSDREAELALQLKA
ASAAVEEEDDKAGPAKNTGGGLEREDAEERETAELDLNCDPHREEEALLAEAAGISLTTL
MNAVTSLPLDMAYVGPPNGAVSTEEIDATVAAVDGDLAEGNNRKDGPGGFNPI
Download sequence
Identical sequences A0A022S400
mgv1a027022m|PACid:17684859

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]