SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for A0A023B6P0 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  A0A023B6P0
Domain Number 1 Region: 389-443
Classification Level Classification E-value
Superfamily RING/U-box 6.13e-19
Family RING finger domain, C3HC4 0.0068
Further Details:      
 
Domain Number 2 Region: 209-274
Classification Level Classification E-value
Superfamily Cdc48 domain 2-like 0.0000000232
Family Cdc48 domain 2-like 0.0021
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) A0A023B6P0
Sequence length 449
Comment (tr|A0A023B6P0|A0A023B6P0_GRENI) Ring finger protein {ECO:0000313|EMBL:EZG66668.1} KW=Complete proteome; Reference proteome OX=110365 OS=Gregarina niphandrodes (Septate eugregarine). GN=GNI_077860 OC=Eugregarinorida; Gregarinidae; Gregarina.
Sequence
MPHPTEDNNIGDSDAATLSDFERQLTGHSCGVCVSTQNRIFRAYVAVKSNTLHKPREETI
RDYRLGPRIEGKIREIAIALLPGEEGDSSEAGKSPSESPAWKTAPASWVKSIKEVLTFGK
SLADSKGADEIRGRSQSEEQEEMLVALANALKERFAKRKCVLIYGGMHVKVAGQRLLITS
AIGEDQELAFCGLGTGDTVVTPALDDPGEFSKIHVCPFMDTIPQAYEMDIFQDALSPFFA
KHPLVLLAEGDTFQYNSVEFKVVSSKPASVPVRISLEKALSLPIEELIQSIPVNKRKHRV
GPSTAVCLGFPILPHWIDILSPARQHIVMSLPAPIQSLMLINFVSETGPSEIERVMNATE
AMGRPQLTPAARVKEMADSVSKLRVDVSKTMEEDGVCIICLGNLEKNDEIVKLSCSHVFH
SKCLLHWLVRTKTCPLCKVELTDIDLPKT
Download sequence
Identical sequences A0A023B6P0
XP_011130539.1.81794

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]