SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for A0A023JBD3 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  A0A023JBD3
Domain Number 1 Region: 82-431
Classification Level Classification E-value
Superfamily gp120 core 4.12e-178
Family gp120 core 0.000000000165
Further Details:      
 
Domain Number 2 Region: 479-603
Classification Level Classification E-value
Superfamily Virus ectodomain 4.08e-59
Family Virus ectodomain 0.00000881
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) A0A023JBD3
Sequence length 801
Comment (tr|A0A023JBD3|A0A023JBD3_9HIV1) Envelope glycoprotein gp160 {ECO:0000256|SAAS:SAAS00936864} OX=11676 OS=Human immunodeficiency virus 1. GN=env OC=Lentivirus; Primate lentivirus group. OH=9606
Sequence
MKVRGILRNYQHWWIWGILGFWMLMICSGNLWVTVYYGVPVWQEAKTTLFCASDAKAYEK
EVHNVWATHACVPTDPNPQEMVLENVTENFNMWKNDMVDQMHEDIISLWDQSLKPCVKLT
PLCVTLNCDKQKKEYALFYKLDIVPLNEYTLINCNTSAVTQACPKVSFDPIPIHYCAPAG
YAILKCNNKTFNGTGPCNNVSTVQCTHGIKPVVSTQLLLNGSLAEKEIIVRSENITNNVK
TIIVHLNESVEIKCIRPGNNTSRSIRIGPGQTFYATGRIVGDIRQAHCNISEEAWNKTLQ
RVSRKLAEHFPNKTIKFEPHSGGDLEITMHSFNCRGEFFYCNTSRLFNSTYSNNITLQCK
LKQIIRRWQGVGQAMYAPPIEGNITCNSNITGLLLVRDGGTNDTETFRPGGGDMRDNWRS
ELYKYKVVEIKPLGVAPTKAKRRVVEREKRAVGIGAVFLGFLGAAGSTMGAASITLTVQA
RQLLSGIVQQQSNLLRAIEAQQHMLQLTVWGIKQLQARVLAMERYLKDQQLLGIWGCSNK
LICTTAVPWNNSWSNKSQDEIWNNMTWMQWDREINNYTNTIYRLLEESQNQQEKNEKDLL
ALDSWQNLWNWFGISNWLWYIRIFIMVVGGLIGLRIIFAILSLVNRVRQGYSPLSFQTLT
PSQRELDRLRGIEEEGGEQDRDRSIRLANGFLALAWEDLRRLCLFSYHRLRDLILVTARA
VELLGRSSLRGLQRGWEALKYLGSLIQYWGLELKKSAISLLDTIAIAVAEGTDRIIELVQ
RICRAIRNIPRRIRQGFEAAL
Download sequence
Identical sequences A0A023JAR6 A0A023JBD3 A0A023JBP1 A0A023JBP7 A0A023JBT3 A0A023JBT8

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]