SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for A0A023XT08 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  A0A023XT08
Domain Number 1 Region: 1-281
Classification Level Classification E-value
Superfamily alpha/beta-Hydrolases 4.41e-53
Family Haloalkane dehalogenase 0.0000011
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) A0A023XT08
Sequence length 292
Comment (tr|A0A023XT08|A0A023XT08_BRAJP) Haloalkane dehalogenase {ECO:0000256|HAMAP-Rule:MF_01231} KW=Complete proteome OX=476282 OS=Bradyrhizobium japonicum SEMIA 5079. GN=BJS_04753 OC=Bradyrhizobiaceae; Bradyrhizobium.
Sequence
MAYREAGDRDAPAALFLHGNPTSSHIWRNILPLVAPVAHCIAPDLVGFGQSGKPDIGYRF
VDHVRYLDAFIEQRGVKSAYLVAQDWGTALAFHLAARRPDFVRGLVFMEFIRPMPTWQDF
HHTEIAEEQDHAEAARAAFRKFRTPGEGEAMILEANAFVERVLPGGIVRKLGEDEMAPYR
APFPTPESRRPVLAFPRELPIAGEPADVYETLQSAHAALAASSYPKLLFSGTPGALVAPE
FAERFAASLKHCALVRLGPGLHFLQEDHPEAIGRSVAGWIAGIEAVRQQRAA
Download sequence
Identical sequences A0A023XT08

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]