SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for A0A024DAI1 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  A0A024DAI1
Domain Number 1 Region: 1-81,108-276
Classification Level Classification E-value
Superfamily gp120 core 1.96e-64
Family gp120 core 0.0000315
Further Details:      
 
Domain Number 2 Region: 324-442
Classification Level Classification E-value
Superfamily Virus ectodomain 3.89e-44
Family Virus ectodomain 0.00000683
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) A0A024DAI1
Sequence length 602
Comment (tr|A0A024DAI1|A0A024DAI1_SIV) Envelope glycoprotein gp160 {ECO:0000256|SAAS:SAAS00936864} OX=11723 OS=Simian immunodeficiency virus (SIV). GN=env OC=Lentivirus; Primate lentivirus group. OH=9598
Sequence
GYALLKCNDHDYRGHKNCQNVSVAACTGLINTTISTGIGINGSRAENRTEIWQEDGDSND
TVIIKLNKYYNLTIRCKRPGNKTVLPVTIMAGLVFHSQKYNTRLKQAWCWFGGNWTQAWK
EVRETIVKLPNTTYKGTRNISQIFLQRQWGDPESENFFFNCQGEFFYCKMDWFLNYLNNQ
SVDPHHNPCNKTGDKKCWQRTYVPCHIRQVVNDWYTLTKKTYAPPREGHLECTSTATALY
VELNYNSNNRTNVTLSPQIRSIWSYELGNYKLVEIKPIGFAPTEVRRYTGPERQKRVPFV
LGFLGFLGAAGAAMGAAATALTVQSQQLLAGILQQQKNLLAAVEQQQQMLKLTIWGVKNL
NARVTALEKYLEDQARLNIWGCAFRQICHTTVPWKFNSTPDWNNMTWQEWERQIGDLEGN
ISRTLEEAHEQEQKNLDSYQKLVSWSDFWSWFDLSRWFGWLKIGFLVIAGIIGLRIVFIV
IGLLRKFKAGYAPLSSLPSYNQQIHIHLDKEQPGREEEPDKGGPSSDSRSYTWQREFLHH
LLSPLINLLRSLINWFLTTCRHLLSPLRQCLETTRQGTRSTRAYLEYGWQEFKAAAAALA
LA
Download sequence
Identical sequences A0A024DA93 A0A024DA98 A0A024DAE7 A0A024DAH1 A0A024DAI1 A0A024DAI6 A0A024DB23 A0A024DBD1 A0A024DBG1 A0A024DBZ6 A0A024DC41

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]