SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for A0A024GGF5 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  A0A024GGF5
Domain Number 1 Region: 338-469
Classification Level Classification E-value
Superfamily Chaperone J-domain 4.06e-25
Family Chaperone J-domain 0.00014
Further Details:      
 
Domain Number 2 Region: 14-113
Classification Level Classification E-value
Superfamily Ubiquitin-like 0.0000589
Family DIX domain 0.054
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) A0A024GGF5
Sequence length 475
Comment (tr|A0A024GGF5|A0A024GGF5_9STRA) Uncharacterized protein {ECO:0000313|EMBL:CCI45942.1} KW=Complete proteome; Reference proteome OX=65357 OS=Albugo candida. GN=BN9_068520 OC=Albugo.
Sequence
MTTSSPATDALWAFYYIQGEDGEDRSHPNAFKVPYSGSSDITLADIHRHFPLKNPSEFHF
RFRLNTVVRGTPISDHNGKTASSNKHTFFWLDITSTKQKVPLSNGRIICKLLRLQKPQRI
GLIFQRKPVSIQTRIQKDQAVKIRCSHANASELDMRTSDYTEAEGGGAYGHPGTPHKEYQ
ASAKRNENTNQQSSTNKVPVEQKAEKSRTSNESFEDFLSGGGPGKPTRGAGIDGNNVNLM
IDHAWNQEGSAANMPRSSTSPNFLNSMDPLTQKKTPQTINAASSKTQAPPAFDDDGGQTV
GPVTLAEMRKYATSTSDGSNVYNPSLIDKSTKSEFVRRAMEERERKMNEEITKARQALQQ
REEAQRLISTQKEQAYVMIGPKLKAWAEDNGRIKNIRTLLSTMHLVMWENSKWQEVNMGK
LIQPQDVKKVYRKAMIVVHPDKSRGCNAEELLIAERVFAAVNTAWEEFITTNPCQ
Download sequence
Identical sequences A0A024GGF5

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]