SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for A0A024R277 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  A0A024R277
Domain Number 1 Region: 58-469
Classification Level Classification E-value
Superfamily PLP-dependent transferases 4.83e-82
Family GABA-aminotransferase-like 0.0000462
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) A0A024R277
Sequence length 473
Comment (tr|A0A024R277|A0A024R277_HUMAN) Serine palmitoyltransferase, long chain base subunit 1, isoform CRA_a {ECO:0000313|EMBL:EAW62805.1} OX=9606 OS=Homo sapiens (Human). GN=hCG_1985323 OC=Catarrhini; Hominidae; Homo.
Sequence
MATATEQWVLVEMVQALYEAPAYHLILEGILILWIIRLLFSKTYKLQERSDLTVKEKEEL
IEEWQPEPLVPPVPKDHPALNYNIVSGPPSHKTVVNGKECINFASFNFLGLLDNPRVKAA
ALASLKKYGVGTCGPRGFYGTFDVHLDLEDRLAKFMKTEEAIIYSYGFATIASAIPAYSK
RGDIVFVDRAACFAIQKGLQASRSDIKLFKHNDMADLERLLKEQEIEDQKNPRKARVTRR
FIVVEGLYMNTGTICPLPELVKLKYKYKARIFLEESLSFGVLGEHGRGVTEHYGINIDDI
DLISANMENALASIGGFCCGRSFVIDHQRLSGQGYCFSASLPPLLAAAAIEALNIMEENP
GIFAVLKEKCGQIHKALQGISGLKVVGESLSPAFHLQLEESTGSREQDVRLLQEIVDQCM
NRSIALTQARYLEKEEKCLPPPSIRVVVTVEQTEEELERAASTIKEVAQAVLL
Download sequence
Identical sequences A0A024R277 O15269
gi|5454084|ref|NP_006406.1| 9606.ENSP00000262554 ENSP00000262554 ENSP00000262554 NP_006406.1.87134 NP_006406.1.92137 ENSP00000262554 Hs5454084___KOG1358

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]