SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for A0A024R2X3 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  A0A024R2X3
Domain Number 1 Region: 31-350
Classification Level Classification E-value
Superfamily (Trans)glycosidases 7.26e-124
Family Bee venom hyaluronidase 0.0000149
Further Details:      
 
Weak hits

Sequence:  A0A024R2X3
Domain Number - Region: 413-432
Classification Level Classification E-value
Superfamily EGF/Laminin 0.0964
Family EGF-type module 0.067
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) A0A024R2X3
Sequence length 435
Comment (tr|A0A024R2X3|A0A024R2X3_HUMAN) Hyaluronoglucosaminidase {ECO:0000256|RuleBase:RU610713} OX=9606 OS=Homo sapiens (Human). GN=hCG_17459 OC=Catarrhini; Hominidae; Homo.
Sequence
MAAHLLPICALFLTLLDMAQGFRGPLLPNRPFTTVWNANTQWCLERHGVDVDVSVFDVVA
NPGQTFRGPDMTIFYSSQLGTYPYYTPTGEPVFGGLPQNASLIAHLARTFQDILAAIPAP
DFSGLAVIDWEAWRPRWAFNWDTKDIYRQRSRALVQAQHPDWPAPQVEAVAQDQFQGAAR
AWMAGTLQLGRALRPRGLWGFYGFPDCYNYDFLSPNYTGQCPSGIRAQNDQLGWLWGQSR
ALYPSIYMPAVLEGTGKSQMYVQHRVAEAFRVAVAAGDPNLPVLPYVQIFYDTTNHFLPL
DELEHSLGESAAQGAAGVVLWVSWENTRTKESCQAIKEYMDTTLGPFILNVTSGALLCSQ
ALCSGHGRCVRRTSHPKALLLLNPASFSIQLTPGGGPLSLRGALSLEDQAQMAVEFKCRC
YPGWQAPWCERKSMW
Download sequence
Identical sequences A0A024R2X3 Q12794
gi|24497562|ref|NP_149349.2| gi|24497564|ref|NP_695013.1| gi|6224976|ref|NP_009296.1| NP_149349.2.87134 NP_149349.2.92137 NP_695013.1.87134 NP_695013.1.92137 XP_011531969.1.92137 XP_011531970.1.92137 XP_011531971.1.92137 9606.ENSP00000266031 ENSP00000266031 ENSP00000346068 ENSP00000378576 ENSP00000477903 ENSP00000266031 ENSP00000458609 ENSP00000266031 ENSP00000346068 ENSP00000378576 ENSP00000459254 ENSP00000460624 ENSP00000461261

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]