SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for A0A024R390 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  A0A024R390
Domain Number 1 Region: 228-380
Classification Level Classification E-value
Superfamily Ribonuclease H-like 1.63e-26
Family DnaQ-like 3'-5' exonuclease 0.001
Further Details:      
 
Domain Number 2 Region: 505-664
Classification Level Classification E-value
Superfamily RNA-binding domain, RBD 1.78e-16
Family Canonical RBD 0.007
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) A0A024R390
Sequence length 774
Comment (tr|A0A024R390|A0A024R390_HUMAN) Exonuclease NEF-sp, isoform CRA_a {ECO:0000313|EMBL:EAW66841.1} OX=9606 OS=Homo sapiens (Human). GN=hCG_38251 OC=Catarrhini; Hominidae; Homo.
Sequence
MEPEREGTERHPRKVRESRQAPNKLVGAAEAMKAGWDLEESQPEAKKARLSTILFTDNCE
VTHDQLCELLKYAVLGKSNVPKPSWCQLFHQNHLNNVVVFVLQGMSQLHFYRFYLEFGCL
RKAFRHKFRLPPPSSDFLADVVGLQTEQRAGDLPKTMEGPLPSNAKAAINLQDDPIIQKY
GSKKVGLTRCLLTKEEMRTFHFPLQGFPDCENFLLTKCNGSIADNSPLFGLDCEMCLTSK
GRELTRISLVAEGGCCVMDELVKPENKILDYLTSFSGITKKILNPVTTKLKDVQRQLKAL
LPPDAVLVGHSLDLDLRALKMIHPYVIDTSLLYVREQGRRFKLKFLAKVILGKDIQCPDR
LGHDATEDARTILELARYFLKHGPKKIAELNLEALANHQEIQAAGQEPKNTAEVLQHPNT
SVLECLDSVGQKLLFLTRETDAGELPSSRNCQTIKCLSNKEVLEQARVEIPLFPFSIVQF
SFKAFSPVLTEEMNKRMRIKWTEISTVYAGPFSKNCNLRALKRLFKSFGPVQSMTFVLET
RQPHLCIQYEVLEAAQLAIESLDGILVDGICIKVQRPVTELTLDCDTLVNELEGDSENQG
SIYLSGVSETFKEQLLQEPRLFLGLEAVILPKDLKSGKQKKYCFLKFKSFGSAQQALNIL
TGKDWKLKGRHALTPRHLHAWLRGLPPESTRLPGLRVVPPPFEQEALQTLKLDHPKIAAW
RWSRKIGKLYNSLCPGTLCLILLPGTKSTHGSLSGLGLMGIKEEEESAGPGLCS
Download sequence
Identical sequences A0A024R390 Q96IC2
ENSP00000261377 ENSP00000457616 NP_001185982.1.87134 NP_001185982.1.92137 NP_112203.2.87134 NP_112203.2.92137 XP_005255661.1.92137 XP_011544265.1.92137 9606.ENSP00000261377 gi|222136613|ref|NP_112203.2| gi|312261259|ref|NP_001185982.1| ENSP00000261377 ENSP00000261377 ENSP00000457616

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]